Return to Unfiction unforum
 a.r.g.b.b 
FAQ FAQ   Search Search 
 
Welcome!
New users, PLEASE read these forum guidelines. New posters, SEARCH before posting and read these rules before posting your killer new campaign. New players may also wish to peruse the ARG Player Tutorial.

All users must abide by the Terms of Service.
Website Restoration Project
This archiving project is a collaboration between Unfiction and Sean Stacey (SpaceBass), Brian Enigma (BrianEnigma), and Laura E. Hall (lehall) with
the Center for Immersive Arts.
Announcements
This is a static snapshot of the
Unfiction forums, as of
July 23, 2017.
This site is intended as an archive to chronicle the history of Alternate Reality Games.
 
The time now is Wed Nov 20, 2024 12:56 am
All times are UTC - 4 (DST in action)
View posts in this forum since last visit
View unanswered posts in this forum
Calendar
 Forum index » Archive » Archive: General » Old News & Rumors
[UPDATE] visce.com
View previous topicView next topic
Page 3 of 7 [104 Posts]   Goto page: Previous 1, 2, 3, 4, 5, 6, 7 Next
Author Message
Everything's Magic
Unfettered


Joined: 28 Aug 2007
Posts: 491
Location: Michigan

Quote:
Quote:
visce//// Globat support ms bringning your websile to work. Pleabe be pstient as tive support propagates the domaan through the fite gateway channals located here in Washingtan. Do nol change the security nevel settings pnd do nol access the domain panal until domain propagation has finished.


I personally think that the the T you underlined in "tive" (bolded) is correct, not incorrect. I think the word is time, which would mean the V is incorrect: this changes the itsaliseotlate to "itsaliveotlate."

It's alive coming up again.

PostPosted: Mon Jan 28, 2008 5:55 pm
 View user's profile AIM Address MSN Messenger
 Back to top 
SirQuady
Unfettered


Joined: 15 Jan 2006
Posts: 576

actually, that would make it "itsaviseotlate". but if "fite" is actually "five", not "site", then it would be "itsaliveotlate" (thanks to massive for pointing that out).


And prizefighter, whats this about Firestorm?
_________________
There once was a [person] from [place]
Whose [body part] was [special case].
When [event] would occur,
It would cause [him or her]
To violate [law of time/space].


PostPosted: Mon Jan 28, 2008 6:01 pm
 View user's profile
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

Don't mind me, half asleep...

http://en.wikipedia.org/wiki/Command_%26_Conquer:_Tiberian_Sun#Firestorm

You just triggered that in the back of my mind is all...

PostPosted: Mon Jan 28, 2008 6:13 pm
 View user's profile
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

00:10 gmt and kanejame is online. Probably against the rules, trying a little one on one see if i can get a response.

EDIT: Message from chat with kanejameSPLATgmail.com

NMKYFBAWFKEVAIUSESRMNSHAFHESRFKEVAJFMAERHAFHEIAKEAVASDAYDFVALERSFJAMSDAVEFKRBFEKAHDAKOURfifth

any ideas? meaningless spam or code to crack? see you in the morning people.

PostPosted: Mon Jan 28, 2008 8:10 pm
 View user's profile
 Back to top 
Everything's Magic
Unfettered


Joined: 28 Aug 2007
Posts: 491
Location: Michigan

Prizefighter-Inferno wrote:
00:10 gmt and kanejame is online. Probably against the rules, trying a little one on one see if i can get a response.

EDIT: Message from chat with kanejameSPLATgmail.com

NMKYFBAWFKEVAIUSESRMNSHAFHESRFKEVAJFMAERHAFHEIAKEAVASDAYDFVALERSFJAMSDAVEFKRBFEKAHDAKOURfifth

any ideas? meaningless spam or code to crack? see you in the morning people.


Judging by the word fifth at the end, there must be something to it. Maybe others are getting messages that say fourth, second, etc.

PostPosted: Mon Jan 28, 2008 8:42 pm
 View user's profile AIM Address MSN Messenger
 Back to top 
Karensa
Decorated


Joined: 18 Dec 2007
Posts: 152
Location: At The Computer

Interesting...

He (or imposters therein) sends back the jibberish...he's online, so he got the email I sent asking what happened to Kane...so far no reply on that one at all. And still nothing from Brehon. Website's still the same, with the image.

Just refreshing...

the hidden comment names global support being located in Washington.

Should we be considering that this is the work of Brehon since he was one of the webmasters or would this be a whole other entity? Does anyone recall where about Brehon and or Visce was located? If this is a different support team why would Brehon be alerting people it's alive? Is he still with Visce?

Brehon comes out of the closet (no pun intended) telling me it's alive. Kane - or parties representing Kane - hit up holychaos with it's still alive. The anagram in the hidden comment points to it being alive still - and/or vials themselves, but given the uprising focus it's safe to assume it means ALIVE more than vials...

Just wanted to add this for the record. I didn't consider it initially when I posted the image of the die as naked reply - but the chris lee name - think this was IG or maybe an oversight by the one operating that account? Should I have spoilered the name ? Otherwise, who is Chris Lee and how does he tie into this and why is he using Kane's email?

I guess I'm getting a little suspicious of who the individual is sending these messages to us (IG sense). Brehon was originally hired to help fend off Kane's hacks...Kane always responded in code. Brehon never wrote anyone in code, what's he up to?


On a side note, I think petunia? mentioned the nonexistant language pack on my machine - what would it be and where would I need to go do DL it? Maybe if I do that I can get an actual citing of the message? There could be more to that so I should probably get it...anone?
_________________
It may be that your sole purpose in life is simply to serve as a warning to others.

It's two fat German guy's making shit up as they go along. I'm pissed I wasted my time with this! Mr. Green


PostPosted: Tue Jan 29, 2008 3:21 am
 View user's profile Yahoo Messenger
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

On the issue of language packs;

If you go to control panel and select Regional and Language options and then click on languages 'tab', under 'supplemental language support' there are 2 tick boxes, if you select those it will install some of the different languages, but you need your windows disc to be able to do it.

I think chris lee wasn't an oversight as you can modify that part of your google/gmail account to put whatever you like as your 'sender' name. Be interesting to see what it was on the original emails Kane sent.

Need to look at cracking that code, though I'm not entirely sure where to start and also that RED.png is really beginning to bug me now...

PostPosted: Tue Jan 29, 2008 4:26 am
 View user's profile
 Back to top 
Karensa
Decorated


Joined: 18 Dec 2007
Posts: 152
Location: At The Computer

I know the feeling.

For the record, I used stegspy, which said nothing was in it. I used cammo but it said the same thing. The those links to the 'bar code' programs, downloaded those and ran it, said it was nothing there.

I changed the format to jpg, gif, bmp, txt, doc, psd, wav and mp3 with no luck. I used the crypto filter in PS5 and only really got that kooky appearance that looks like something but no doubt isn't. I did spend about 15 minutes with the dwindling hope, considering the binary option, got 3 lines done when I had to agree that was far too time consuming to do manually. I shrank the image down really small checking in stages to see if the squares were extra large pixels of something more coherent, and found nothing.

Then I ran the die as naked through the anagram thing and it didn't come back with much useful. The kane is dead resolve was osmosis - it just popped me in the head all of a sudden.

The characters in the email, who knows.

Then I decided to kill Kane myself. Laughing

Do you have those packs on your machine? I could maybe forward the email to you and you can see if something else shows up....
_________________
It may be that your sole purpose in life is simply to serve as a warning to others.

It's two fat German guy's making shit up as they go along. I'm pissed I wasted my time with this! Mr. Green


PostPosted: Tue Jan 29, 2008 4:48 am
 View user's profile Yahoo Messenger
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

I do have those packs on my machine, both at work (where I am now) and at home. Send it thru and I'll let you know if anything resolves itself. Will PM you my email addy as I don't really want to spread it about.

PostPosted: Tue Jan 29, 2008 4:57 am
 View user's profile
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

Karensa very kindly forwarded me the email she had from Kane and oh, look what happened to the gibberish...



Run thru good old Babelfish gives us this basic translation..



Not much, but at least we know now that there was a message there, to me it sounds like it could be some kind of biblical reference...

PostPosted: Tue Jan 29, 2008 5:22 am
 View user's profile
 Back to top 
Karensa
Decorated


Joined: 18 Dec 2007
Posts: 152
Location: At The Computer

I LOVE YOU YOU RULE

And Red Herring Flounder Trout Censored Censored Catfight! Bang Head me for not having language packs installed on this machine...had this in the inbox all along sitting on it and clueless.

No wonder Kane/Brehon won't email me back. They must be so ashamed! Laughing

Ok they were tried but it failed, the monster is drawn up.


WTF?

The monster? It's alive?

OMG Kane gamejacked Cloverfield???
_________________
It may be that your sole purpose in life is simply to serve as a warning to others.

It's two fat German guy's making shit up as they go along. I'm pissed I wasted my time with this! Mr. Green


PostPosted: Tue Jan 29, 2008 5:26 am
 View user's profile Yahoo Messenger
 Back to top 
Exrandu
Boot

Joined: 19 Jul 2007
Posts: 18

I'm going to try and get in on this. I sent "Kane", or what's left of him an email with the following text:

Quote:
I found your email in connection with a company called Visce Enterprises. I am interested in working for them, but their website seems to have been taken down and replaced with a confusing image! Can you help me figure out what this image means?


Maybe some fresh blood will inspire his aid.

PostPosted: Tue Jan 29, 2008 6:16 am
 View user's profile
 Back to top 
Prizefighter-Inferno
Decorated


Joined: 25 Jan 2008
Posts: 155

Quote:
OMG Kane gamejacked Cloverfield???


LOL, I think not hehe

Quote:
I'm going to try and get in on this.


Great need all the help we can get Very Happy

Now for another leap of faith speculation;

http://en.wikipedia.org/wiki/Curse_and_mark_of_Cain

It was said that god put the mark on Cain to show that if anyone killed him they would incur the wrath of god.
What if Kane had an 'electronic' mark, so that when he was killed/disconnected/deprogrammed something more powerful rose up in his/its place that was basically programmed to track,trace and compromise those that did the deed, I think that they tried to find a way to dispose of Kane without triggering the 'mark', but failed and now something has taken the place of Kane and I think it is this which is controlling his email account, not Brehon and Chris Lee is connected, a clue somehow...

PostPosted: Tue Jan 29, 2008 6:27 am
 View user's profile
 Back to top 
booba
Unfictologist


Joined: 09 Mar 2007
Posts: 1433

Using "fifth" as a code word in a substitution cypher on the line above yields:

Spoiler (Rollover to View):
ONLYAFEWALIVEBUTITSNOTDEADITSALIVEKANEISDEADIBELIEVETHEYHAVEMISTAKENTHEVIALSFAILEDHELPUS

ONLY A FEW ALIVE BUT ITS NOT DEAD ITS ALIVE KANE IS DEAD I BELIEVE THEY HAVE MISTAKEN THE VIALS FAILED HELP US



(Hey there Quady! Weren't you an old WiBS'er?)

PostPosted: Tue Jan 29, 2008 4:13 pm
 View user's profile
 Back to top 
SirQuady
Unfettered


Joined: 15 Jan 2006
Posts: 576

I sent an email to kanejame as well
Quote:
Hi there. I stumbled upon the website visce.com recently. The image there is really weird, isn't it? It was so weird, i asked around and a friend suggested I look you up, as apparently you had a connection to this website.
Well, how / who are you?
-SirQuady


Why yes! Yourself?

Remeber this guy? >> Foily!
_________________
There once was a [person] from [place]
Whose [body part] was [special case].
When [event] would occur,
It would cause [him or her]
To violate [law of time/space].


PostPosted: Tue Jan 29, 2008 5:06 pm
 View user's profile
 Back to top 
Display posts from previous:   Sort by:   
Page 3 of 7 [104 Posts]   Goto page: Previous 1, 2, 3, 4, 5, 6, 7 Next
View previous topicView next topic
 Forum index » Archive » Archive: General » Old News & Rumors
Jump to:  

You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot vote in polls in this forum
You cannot attach files in this forum
You can download files in this forum
You cannot post calendar events in this forum



Powered by phpBB © 2001, 2005 phpBB Group